P Glycoprotein/ABCB1 Antibody orb234261 from Biorbyt

Product Specs
ItemP Glycoprotein/ABCB1 Antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb234261
Quantity10 µg, 100 µg
ApplicationsIHC
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Mouse, Rat
TargetP Glycoprotein/ABCB1
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein (621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids
NCBI Full Gene NameATP binding cassette subfamily B member 1
NCBI Gene AliasesABC20, CD243, CLCS, GP170, MDR1, P-GP, PGY1, p-170
ClonalityPolyclonal
Molecular Weight141479 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Mouse, Rat, -Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat

Add to Compare List